{ { }, ] if (2 != val) { ] ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } { } "context" : "", ] if (val.trim() == "") "triggerEvent" : "LITHIUM:triggerDialogEvent", "message" : "2115946", "event" : "addMessageUserEmailSubscription", ] "context" : "envParam:quiltName,expandedQuiltName", "event" : "markAsSpamWithoutRedirect", "event" : "ProductAnswerComment", $(event.data.selector).addClass('cssmenu-open') "selector" : "#messageview_0", { } } "componentId" : "forums.widget.message-view", "forceSearchRequestParameterForBlurbBuilder" : "false", }, var o = document.getElementById("custom_board_pagination_warning" + pagerId); var key = e.keyCode; ], }, "eventActions" : [ LITHIUM.Auth.CHECK_SESSION_TOKEN = 'F7g4VpgMwjUOaBIHIy35rTWSpjMvT8uUzuSk7a8fErk. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); "action" : "rerender" "actions" : [ ] }, { "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "event" : "MessagesWidgetEditCommentForm", "useSubjectIcons" : "true", ] "parameters" : { { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2114607 .lia-rating-control-passive', '#form_0'); "actions" : [ setWarning(pagerId); "actions" : [ "context" : "envParam:feedbackData", "useSubjectIcons" : "true", "event" : "RevokeSolutionAction", "event" : "ProductAnswerComment", }; "event" : "MessagesWidgetEditAnswerForm", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "action" : "pulsate" "action" : "rerender" ] }, }, "action" : "pulsate" }, "event" : "ProductAnswerComment", }, "kudosLinksDisabled" : "false", ] "displaySubject" : "true", } return; "actions" : [ "action" : "rerender" "event" : "MessagesWidgetCommentForm", "initiatorBinding" : true, { var notifCount = 0; }, function setWarning(pagerId) { ] "actions" : [ "context" : "", { "actions" : [ "dialogKey" : "dialogKey" ] "action" : "pulsate" "actions" : [ { ] }, $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); expireDate.setDate(expireDate.getDate() + 365*10); "event" : "removeThreadUserEmailSubscription", } "quiltName" : "ForumMessage", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); ], LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'R70WWMPHJNtY1vteNiObgWyKRGEqG5mBRyozDKJQLWU. "context" : "", "componentId" : "kudos.widget.button", "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'RxGp4GxeFjKKa6uxl-V2wFrN9bJ8Y4NE8_-iLOnqp8I. "}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); } "actions" : [ { "actions" : [ }); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2114607 .lia-rating-control-passive', '#form_0'); if ( Number(val) < 1 ) }); This is a short howto explaining how to set up a full-NAT on a Mikrotik RouterOS. // Set start to true only if the first key in the sequence is pressed "event" : "ProductMessageEdit", "dialogKey" : "dialogKey" "actions" : [ var count = 0; { LITHIUM.AjaxSupport.ComponentEvents.set({ "componentId" : "forums.widget.message-view", { { "event" : "unapproveMessage", } ;(function($) { $('.css-menu').removeClass('cssmenu-open') "actions" : [ "actions" : [ ;(function($) { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "actions" : [ }); { "event" : "MessagesWidgetEditAction", { { ], if (val.trim() == "") "action" : "rerender" LITHIUM.Dialog({ { if ( key == neededkeys[0] ) { }, "disableLabelLinks" : "false", if (isNaN(val) ) "event" : "MessagesWidgetMessageEdit", "displayStyle" : "horizontal", "action" : "rerender" "action" : "rerender" "truncateBodyRetainsHtml" : "false", ] { }); { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":233970}); "action" : "rerender" ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qCjDCZQq15Pz1bNMHXSI4A00k17OFNXT9VneLLetqrc. } } "context" : "envParam:selectedMessage", { { } { { { LITHIUM.AjaxSupport.ComponentEvents.set({ "; }, { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; ] "context" : "envParam:quiltName,expandedQuiltName", { "; "event" : "MessagesWidgetEditCommentForm", "event" : "markAsSpamWithoutRedirect", "context" : "envParam:selectedMessage", } "disableLinks" : "false", { "actions" : [ } o.innerHTML = "Page must be in a numeric format. ] ] lithadmin: [] "event" : "kudoEntity", ], }, { return false; "actions" : [ "action" : "addClassName" { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2114607,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "ProductAnswerComment", } "; { "event" : "MessagesWidgetEditCommentForm", } if (2 != val) ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"D5TbFHi7MHUJG2roIVjdlbBlV2iBHjlnHxWY-qPgdJA. I am just wondering what my NAT type is and how I would check it. } }, "displaySubject" : "true", { "componentId" : "forums.widget.message-view", "event" : "MessagesWidgetCommentForm", { //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} { "action" : "rerender" "kudosLinksDisabled" : "false", }, { { "displayStyle" : "horizontal", "action" : "rerender" }, { "context" : "", ] "action" : "rerender" "context" : "", } "actions" : [ "action" : "rerender" "actions" : [ { if (element.hasClass('active')) { "event" : "editProductMessage", "context" : "", ] LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2083819}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114607}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2114755}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2115946}},{"elementId":"link_24","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2459463}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2496296}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2469222}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504244}},{"elementId":"link_28","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497294}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510752}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510688}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510594}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510201}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510197}},{"elementId":"link_40","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510133}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510098}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509619}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509545}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509333}}]); } "actions" : [ "action" : "rerender" "useSimpleView" : "false", o.innerHTML = ""; "event" : "MessagesWidgetAnswerForm", o.innerHTML = "Page number can\'t exceed 2. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); "actions" : [ "linkDisabled" : "false" "useCountToKudo" : "false", function clearWarning(pagerId) { } }, "event" : "kudoEntity", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "context" : "lia-deleted-state", "action" : "pulsate" } "forceSearchRequestParameterForBlurbBuilder" : "false", } "action" : "rerender" "event" : "approveMessage", "disableLinks" : "false", }); }, { } return; } "context" : "",